PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G116658_P01
Common NameHDZIV3_OCL3, Zm.688
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 863aa    MW: 91541.4 Da    PI: 6.2611
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G116658_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21121176156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  GRMZM2G116658_P01 121 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 176
                        688999***********************************************999 PP

2START172.72.3e-543395721205
                        HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
              START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                        ela++a++el+k a+ +ep+W +s+     e +n de+ + f++  +     + +ea r+ gv +  +++lv +l+d + +W+e+++    +
  GRMZM2G116658_P01 339 ELALAAMEELMKVAQMDEPLWLRSPdgsglEALNLDEYHRAFARVFGpspagYVTEATREAGVAITSSVDLVDSLMDAA-RWSEMFPcivaR 429
                        5899**************************************775559*******************************.************ PP

                        EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE-EESSEEEEE CS
              START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvRaellpSgili 154
                        a+t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p            ++++ ++llp+g+++
  GRMZM2G116658_P01 430 ASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAILRPDGghhhaqnggGAGYMGCRLLPTGCIV 521
                        ***********************************************************95444433322222335899************* PP

                        EEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
              START 155 epksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                        +++ ng+skvtwv h++++++++h+l+r+l++sg+a ga++w+a lqrqc+
  GRMZM2G116658_P01 522 QDMNNGYSKVTWVVHAEYDEAVVHQLYRPLLQSGQALGARRWLASLQRQCQ 572
                        **************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-22103178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-23109178IPR009057Homeodomain-like
PROSITE profilePS5007118.317118178IPR001356Homeobox domain
SMARTSM003891.6E-19119182IPR001356Homeobox domain
PfamPF000464.1E-19121176IPR001356Homeobox domain
CDDcd000866.74E-20121178No hitNo description
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PROSITE profilePS5084841.78330576IPR002913START domain
SuperFamilySSF559618.65E-27334572No hitNo description
CDDcd088759.87E-111336572No hitNo description
PfamPF018523.3E-46339572IPR002913START domain
SMARTSM002342.0E-42339573IPR002913START domain
SuperFamilySSF559616.91E-15650853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAT GGGTGMHNPG RLVPAPPLPK PGGFGATGLS LGLQTNMEGA  60
QLGDLGRMGL IGGGGSGSGG DGDSLGRGRE DEIDSRSGSD NVDGASGDEI DPDNSNPRRK  120
KKRYHRHTPQ QIQELEAVFK ECPHPDEKQR MELSKRLNLE SRQVKFWFQN RRTQMKTQIE  180
RHENALLRQE NDKLRAENMT IREAMRNPIC ANCGGAAVLG EVSLEEQHLR IENARLKDEL  240
DRVCALAGKF LGRPISSGSS MSSSLQGCSG LELAVGSNNG YGPGPLGASA LQPLPDLLGA  300
GLPGPVGSAA MRLPMGIGAL DVALHGAAAD GIDRTVLLEL ALAAMEELMK VAQMDEPLWL  360
RSPDGSGLEA LNLDEYHRAF ARVFGPSPAG YVTEATREAG VAITSSVDLV DSLMDAARWS  420
EMFPCIVARA STTDIISSGM GGTRSGSIQL MHAELQVLSP LVPIREVVFL RFCKQHAEGL  480
WAVVDVSVDA ILRPDGGHHH AQNGGGAGYM GCRLLPTGCI VQDMNNGYSK VTWVVHAEYD  540
EAVVHQLYRP LLQSGQALGA RRWLASLQRQ CQYLAILCSN SLPARDHAAI TPVGRRSMLK  600
LAQRMTDNFC AGVCASAAQK WRRLDEWRSG EGGDAAGNGG SAAAGEGEEK VRMMARHSVG  660
APGDPPGVVL SATTSVRLPA TSPQRVFDYL RDEQRRGEWD ILANGEAMQE MDHIAKGQHH  720
GNAVSLLRPN ATSGNQNNML ILQETCTDPS GSLVVYAPVD VQSMHVVMNG GDSAYVSLLP  780
SGFAILPDGH CQSPNTAHQG SPSCGGSSSS SSTGSLVTVA FQILVNNLPT AKLTVESVET  840
VSNLLSCTIQ KIKSALQASI VTP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117122RRKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.6880.0cell culture| ear| endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G116658
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G116658_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285220.0KJ728522.1 Zea mays clone pUT6827 HB transcription factor (HB14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105125.10.0outer cell layer 3
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLG2J5R70.0G2J5R7_MAIZE; Homeodomain leucine zipper family IV protein
STRINGGRMZM2G116658_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]